SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006549 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006549
Domain Number 1 Region: 347-771
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.84e-108
Family Phosphofructokinase 0.00000709
Further Details:      
 
Domain Number 2 Region: 22-356
Classification Level Classification E-value
Superfamily Phosphofructokinase 4.84e-88
Family Phosphofructokinase 0.00000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006549   Gene: ENSMMUG00000004935   Transcript: ENSMMUT00000006964
Sequence length 783
Comment pep:known_by_projection chromosome:MMUL_1:9:3335752:3406280:1 gene:ENSMMUG00000004935 transcript:ENSMMUT00000006964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGATVLGRGVEDCAGEGGGGVYWR
LGGGFGMISARCNLHLPGSISWCRLSQGGTIIGSARCQAFRTREGRLKAACNLLQRGITN
LCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGT
DMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPE
SPPEQGWEEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTR
VTILGHVQRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECV
QMTQDVQKAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAP
AAGMNAAVRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKR
ILPGKYLEEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSN
NVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGAD
AAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGV
FDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSVCVLG
ISKRNVIFQPVAELKQQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQP
WSV
Download sequence
Identical sequences ENSMMUP00000006549 ENSMMUP00000005583 9544.ENSMMUP00000006549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]