SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006621 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006621
Domain Number 1 Region: 80-125
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.07e-17
Family TRASH domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006621   Gene: ENSMMUG00000005000   Transcript: ENSMMUT00000007048
Sequence length 156
Comment pep:known chromosome:MMUL_1:1:37818391:37832921:-1 gene:ENSMMUG00000005000 transcript:ENSMMUT00000007048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGSAQQPKIQESELKISGVFSVNERPLA
QQLNPGFQLSFTSSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRC
ITRHSSPACLPPPPKKTCTNCSKYKILNIPFYCTFF
Download sequence
Identical sequences ENSMMUP00000006621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]