SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006642 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006642
Domain Number 1 Region: 46-164
Classification Level Classification E-value
Superfamily DNA clamp 9.42e-16
Family DNA polymerase processivity factor 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006642   Gene: ENSMMUG00000005015   Transcript: ENSMMUT00000007069
Sequence length 173
Comment pep:novel chromosome:MMUL_1:14:48865864:48866385:1 gene:ENSMMUG00000005015 transcript:ENSMMUT00000007069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYQGYGYPLRLFLEEGGVVTVCKINTQDPEDTLDFDFCSTNVINKIILQSEGLREAFSE
LDMMSEVLQITMSLDKPYFRLSTFGNARSSHLDYPKDSDLMEAFHCNQIQVNRYKISLLK
PSTKALVLSCKVSIRTDNRGFLSSQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences 9544.ENSMMUP00000006642 ENSMMUP00000006642 ENSMMUP00000006642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]