SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006664 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006664
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily Globin-like 4.7e-40
Family Globins 0.000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006664   Gene: ENSMMUG00000005034   Transcript: ENSMMUT00000007093
Sequence length 154
Comment pep:known chromosome:MMUL_1:10:79520870:79531878:-1 gene:ENSMMUG00000005034 transcript:ENSMMUT00000007093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKH
PGDFGADAQGAMNKALELFRNDMAAKYKELGFQG
Download sequence
Identical sequences A0A2K6DJM1 F7ARV1 G7PFA9 P02150
XP_001081975.2.72884 XP_001082215.1.72884 XP_005567517.1.63531 XP_005567518.1.63531 XP_011710828.1.29376 XP_011710829.1.29376 XP_015005665.1.72884 XP_015312747.1.63531 9544.ENSMMUP00000006664 ENSMMUP00000006664 ENSMMUP00000006664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]