SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006696 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006696
Domain Number 1 Region: 24-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000218
Family EGF-type module 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006696
Domain Number - Region: 64-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000336
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 8-28
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00185
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006696   Gene: ENSMMUG00000005053   Transcript: ENSMMUT00000007126
Sequence length 95
Comment pep:novel chromosome:MMUL_1:4:61038837:61047717:-1 gene:ENSMMUG00000005053 transcript:ENSMMUT00000007126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFFHFFSLRCLPGFSGQFCEININECSSSPCLHGANCEDHINGYVCKCQPGWSGHHCE
KELECVPNSCVHQLCMENEPGSTCLCTPGFMVKII
Download sequence
Identical sequences ENSMMUP00000006696 9544.ENSMMUP00000006696 ENSMMUP00000006696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]