SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006907 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006907
Domain Number 1 Region: 36-153
Classification Level Classification E-value
Superfamily TPR-like 1.09e-19
Family Tetratricopeptide repeat (TPR) 0.0081
Further Details:      
 
Domain Number 2 Region: 830-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000105
Family Classic zinc finger, C2H2 0.054
Further Details:      
 
Domain Number 3 Region: 882-916
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000275
Family CCCH zinc finger 0.0048
Further Details:      
 
Domain Number 4 Region: 497-526
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000804
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006907
Domain Number - Region: 753-785
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000171
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 626-657
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00255
Family CCCH zinc finger 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006907   Gene: ENSMMUG00000005219   Transcript: ENSMMUT00000007349
Sequence length 976
Comment pep:known_by_projection chromosome:MMUL_1:10:85254479:85315707:1 gene:ENSMMUG00000005219 transcript:ENSMMUT00000007349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQNLFAEGNDLFREKDYKQALVQYM
EGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGLYEKALEDSEKALGLDSESIRALF
RKARALNELGRHKEAYECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETF
SLLSNGTAAGVADQGTSNGLGSIDDIETGNVPDMREQVEIEAPDCYVDPRASPALLPSTP
TMPLFPHVLDLLAPLDSSRTLPSTDSLDDFSDGDVFGPELDTLLDSLSLVQGGLSGSGVP
SELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSKKLAASVLDALDPPGPT
LDPLDLLPYSETRLDALDSFGSTRGSLDKPDCFVEETNSQDHRPPSGAQKPAPSPEPCMP
NTALLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCKRDILLGRLRSSEDQT
WKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEIDVWTEERKGTLNRDLL
FDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKGTKDSPSVCSNLAAKHSF
YNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLL
QQYSGEGQAVQVEGGWAGGAGGGRVSQVRGRRCRWRAGVSGEGQAVQVEGGCLRGQAVQV
EGGSIRCECWRGAGGPRGGSDAFQRDSEALPMPTPQLCIHAQNGRKCQYVGNCSFAHSPE
ERDMWTFMKENKILDMQQTYDMWLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGY
HCWLCGKNSNSKKQWQQHIQSEKHKEKVFTSDSDASGWAFRFPMGEFRLCDRLQKGKACP
DGDKCRCAHGQEELNEWLDRREVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDPAGA
TPEAPAAAAAATTTGE
Download sequence
Identical sequences ENSMMUP00000006907 ENSMMUP00000006907 9544.ENSMMUP00000006907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]