SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006922 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006922
Domain Number 1 Region: 65-436
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.6e-125
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006922   Gene: ENSMMUG00000005228   Transcript: ENSMMUT00000007364
Sequence length 549
Comment pep:known chromosome:MMUL_1:1:129627557:129677192:1 gene:ENSMMUG00000005228 transcript:ENSMMUT00000007364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSGPSSSVGFSSFDPAVPSCTSSSASGIKRPVAPEVPYASGMPIKKIGHRSVDSSG
ETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHH
YNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFII
KTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVK
MHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCL
VLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARR
GGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHR
PGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSGSSFSRRVGSSGNSCITYQPSVSGEHKA
QVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPIVGETLQMLTTSTTLEKL
EVAESEFTH
Download sequence
Identical sequences A0A2K5JB59 A0A2K6NG84 H9G0I5
ENSMMUP00000006922 XP_007975433.1.81039 XP_010385504.1.97406 XP_011793244.1.43180 XP_011924963.1.92194 XP_015006344.1.72884 XP_015312947.1.63531 XP_017733207.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]