SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006923 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006923
Domain Number 1 Region: 65-436
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.65e-125
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006923   Gene: ENSMMUG00000005228   Transcript: ENSMMUT00000007365
Sequence length 500
Comment pep:known chromosome:MMUL_1:1:129627557:129677192:1 gene:ENSMMUG00000005228 transcript:ENSMMUT00000007365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSGPSSSVGFSSFDPAVPSCTSSSASGIKRPVAPEVPYASGMPIKKIGHRSVDSSG
ETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHH
YNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELCSSGASGSLFYVSSDDEFII
KTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVK
MHIKYDLKGSTYKRRASQKEREKPLPTFKDLDFLQDIPDGLFLDADMYNALCKTLQRDCL
VLQSFKIMDYSLLMSIHNIDHAQREPLSSETQYSVDTRRPAPQKALYSTAMESIQGEARR
GGTMETDDHMGGIPARNSKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHR
PGFYAERFQRFMCNTVFKKIPCVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPIVGETLQ
MLTTSTTLEKLEVAESEFTH
Download sequence
Identical sequences A0A2K5JB69 A0A2K5M2J2 A0A2K5UVU4 A0A2K6MF21 A0A2K6NG93
XP_011793246.1.43180 ENSMMUP00000006923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]