SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006931 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006931
Domain Number 1 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.15e-23
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 271-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 330-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 1-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-20
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 8 Region: 177-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 541-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 10 Region: 130-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000239
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006931   Gene: ENSMMUG00000005236   Transcript: ENSMMUT00000007374
Sequence length 596
Comment pep:known chromosome:MMUL_1:19:12160144:12163022:-1 gene:ENSMMUG00000005236 transcript:ENSMMUT00000007374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDSVVFEDVAVNFTQEEWALLGPSQKKLYRDVMQETFVNLASIGKTEIIPSLSQLENKCF
LFINKVPRFRMLKGFFWACILGENWEEKNTEDHKNQGRKLRRSHMVERLCERKEGSQFGE
TISQTPNPKPNKKTFTRVKPYECSMCGKDYMCHSSLNRHMRSHTEHRSYEYHKYGEKSYE
CKECGKRFSFRSSFRIHERTHTGEKPYKCKQCGKAFSWPSSFQIHERTHTGEKPYECKEC
GKAFIYHTTFRGHMRMHTGEKPYKCKECGKTFSHPSSFRNHERTHSGEKPYECKQCGKAF
RYYQTFQIHERTHTGEKPYQCKQCGKALSCPTSFRSHERIHTGEKPYKCKKCGKAFSFPS
SFRKHERIHTGEKPYDCKECGKAFISLPSYRRHMIMHTGNGPYKCKECGKAFDCPSSFQI
HERTHTGEKPFECKQCGKAFSCSSSFRMHERTHTGEKPHECKQCGKAFSCSSSVRIHERT
HTGEKPYECKQCGKAFSCSSSFRMHERIHTGEKPYECKQCGKAFSCSSSVRMHERTHTGE
KPYECKQCDKAFSCSRSFRIHERTHTGEKPYACQQCGKAFKCSRSFRIHERVHSGE
Download sequence
Identical sequences ENSMMUP00000006931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]