SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006957 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006957
Domain Number 1 Region: 43-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000493
Family EGF-type module 0.004
Further Details:      
 
Domain Number 2 Region: 119-161
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000132
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 77-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000237
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006957   Gene: ENSMMUG00000005257   Transcript: ENSMMUT00000007401
Sequence length 185
Comment pep:novel chromosome:MMUL_1:4:61242407:61252082:-1 gene:ENSMMUG00000005257 transcript:ENSMMUT00000007401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIIERGLCFLEMFTIMNKLLVLYLNGFMFCLVCSHIGINCEINLDECLSEPCLHDGVCID
GINHYTCDCKSGFFGTHCETNANDCLSNPCLHGRCTEPINEYPCSCDADGTSIQCKIKIN
DCTSMPCMNEGFCQKSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDGP
GHTFD
Download sequence
Identical sequences ENSMMUP00000006957 9544.ENSMMUP00000006957 ENSMMUP00000006957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]