SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006966 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006966
Domain Number 1 Region: 572-930
Classification Level Classification E-value
Superfamily RNI-like 1.28e-45
Family 28-residue LRR 0.00036
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily DEATH domain 6.71e-21
Family Pyrin domain, PYD 0.0065
Further Details:      
 
Domain Number 3 Region: 172-346
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000184
Family Nucleotide and nucleoside kinases 0.058
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000006966
Domain Number - Region: 520-579
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0247
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006966   Gene: ENSMMUG00000005266   Transcript: ENSMMUT00000007411
Sequence length 930
Comment pep:novel chromosome:MMUL_1:19:60938427:60953704:-1 gene:ENSMMUG00000005266 transcript:ENSMMUT00000007411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STMTSPQLEWTLQTLLEQLNEDELKSFKSLLRALPLEDVLQKAPWSEVEEADGKKLAEIL
IHTSSENWIRSATVTVLEEMNLTELCKMAKSEMLEAGQVQEIDNPQLGDAEEDSELAKPG
EKEGRRNSVQKQSLVWKNTFWQGDIDSFHDDVIQRNQRFIPFLNPRTPRKLTPYTVVLHG
PAGVGKTTLAKKCMLDWTDCNLSPTVRYAFYLSCKELSRMGPCSFAELISKDWPELQDDI
PHILAQAQRILFVVDGLDELKVPPGALIQDICGDWEQQKPVPVLLGSLLKRKMLPKATLL
VTTRPRALRDLQLLVQQPIYIRVEGFLEEDRRAYFLRHFGDEDQAMRAFELMRSNAALFQ
LGSAPAVCWIVCTTLKLQMEKGEDPAPTCLTSTGLFLRFLCSQFPQGAQLRGALRALSLL
AAQGLWAQMSVLHGEDLESAGVQESDLRPFLDRDILRQDGVAKGCYSFIHLSFQQFLTAL
FYALEKEEEEDRDGHAWDIGDVQKLLSEEERLKNPDLIQVGHFLFGLANEKRVKELEATF
GCQMSPEIKQELLRCKASLHANKPLSMTDLKEVLCCLYESQEEELAKVVVAPLKKISINL
TNTSEMMHCSFSLKHCRDLEKVSLQIAKGVFLEKCTYVTLPSWAQQDLRSLRLWTDFCSL
FSSNSNLKFLEVKQSFLSDSSVRILCDHITRSTCHLQKVEIKNVTPDTAYRDFCLAFIGK
RTLTHLTLEGHIEWERTMLLLLCDLLRNHKCNLQYLRVLSINLPLIFPTKSSTQAILVLK
ANQSLRHLHLSASVLLDEGAKLLYKTMTHPKHFLQMLSLQQCSITKRGCRYLSEALQEAC
SLTNLDLSLNQIARGLWILCQALENPNCNLKHLRLWSCSLMPFYCQHLGSALISNQKLET
LDLGQNHLWKSGIIQLFRVLRQRTGSLKTL
Download sequence
Identical sequences ENSMMUP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]