SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006984 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006984
Domain Number 1 Region: 41-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.14e-75
Family T-box 0.0000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006984   Gene: ENSMMUG00000005283   Transcript: ENSMMUT00000007432
Sequence length 448
Comment pep:known chromosome:MMUL_1:1:198006600:198037323:1 gene:ENSMMUG00000005283 transcript:ENSMMUT00000007432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMSELGTRKPSDGTVSHLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNE
MIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVPTDSHRWKYVNGEWVPAGKPEVSSHS
CVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGSAHRM
VTNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLRDVPEALSESQHVTC
SHLGGWIFSNPEGVCTAGNSNYQYATPLPLPAPHTHHGCEHYSGLRGHRQAPYPSAYMHR
NHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHTNGPINPGPSPYPCLWTIS
NSAGGPTGPGPEVHASAPGAFLLGNPAVTSPPSVLSTQAPTSAGVEVLGEPSLTSIAVST
WTAVASHPFAGWGGPGAGGHHSPSSLDG
Download sequence
Identical sequences F7BHM6
ENSMMUP00000037704 9544.ENSMMUP00000006984 XP_014980569.1.72884 ENSMMUP00000006984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]