SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006987 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006987
Domain Number 1 Region: 220-282
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 102-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000168
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 71-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000101
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006987   Gene: ENSMMUG00000005287   Transcript: ENSMMUT00000007435
Sequence length 356
Comment pep:known_by_projection chromosome:MMUL_1:1:77936206:77969047:1 gene:ENSMMUG00000005287 transcript:ENSMMUT00000007435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVLSSCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPR
SMASGSGCPPGKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDK
DIFCKLDYFRRYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALV
EEKVLCRVHYDCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVM
QAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPS
RLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPISHT
Download sequence
Identical sequences A0A2I3MED6 A0A2K5MVZ4 A0A2K6AY93
ENSMMUP00000006987 ENSMMUP00000006987 9544.ENSMMUP00000006987 XP_001097664.2.72884 XP_011741172.1.29376 XP_011937601.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]