SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000006989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000006989
Domain Number 1 Region: 210-272
Classification Level Classification E-value
Superfamily Homeodomain-like 1.92e-20
Family Homeodomain 0.0033
Further Details:      
 
Domain Number 2 Region: 92-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000154
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 61-89
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000101
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000006989   Gene: ENSMMUG00000005287   Transcript: ENSMMUT00000007438
Sequence length 346
Comment pep:known_by_projection chromosome:MMUL_1:1:77942700:77969047:1 gene:ENSMMUG00000005287 transcript:ENSMMUT00000007438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPP
GKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFR
RYGTRCSRCGRHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHY
DCMLDNLKREVENGNGISVEGALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNNP
DAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPSRLSPPMLEEM
AYSAYVPQDGTMLTALHSYMDAHSPTALGLQPLLPHSMTQLPISHT
Download sequence
Identical sequences ENSMMUP00000006989 XP_007976461.1.81039 XP_007976462.1.81039 XP_007976463.1.81039 XP_007976464.1.81039 XP_011833192.1.47321 XP_011937602.1.92194 XP_014998158.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]