SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007019 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007019
Domain Number 1 Region: 24-334
Classification Level Classification E-value
Superfamily L domain-like 1.25e-55
Family Ngr ectodomain-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007019   Gene: ENSMMUG00000005304   Transcript: ENSMMUT00000007469
Sequence length 468
Comment pep:known_by_projection chromosome:MMUL_1:X:39257389:39258795:1 gene:ENSMMUG00000005304 transcript:ENSMMUT00000007469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVLGLPRARAVGACARACPTACACSTVERGCSVRCDRAGLLRVPADFPCEAVSIDLDRNG
LRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGDLRYLHARTFAA
LGRLRRLDLAACRLFSVPERLLAELPALRELAAFDNLFRRVPGALRGLANLTHAHLERGR
IEAVASSSLQGLRRLRSLSLQANRVRAVHAGAFGDCGVLEHLLLNDNLLAELPADAFRGL
RRLRTLNLGGNALDRVARAWFVDLAELELLYLDRNSIAFVEEGAFQNLSGLLALHLNSNR
LTVLAWAAFQPGFFLGRLFLFRNPWCCDCRLEWLRDWMEGSGRVTDVPCTSPGSVAGLDL
SRVTFGRSSNGLCVDPEELNLTTSSPGPSPEPAATTVSRFSSLLSKLLAPRVLVEEEANT
TGGLANASLSYSLSSRGVGGAGRQPWFLLTSCLLPSVAQHVVFGLQMD
Download sequence
Identical sequences ENSMMUP00000007019 9544.ENSMMUP00000007019 ENSMMUP00000007019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]