SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007028 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007028
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.94e-31
Family Thioltransferase 0.0000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007028   Gene: ENSMMUG00000005312   Transcript: ENSMMUT00000007479
Sequence length 106
Comment pep:novel chromosome:MMUL_1:6:92028288:92037176:-1 gene:ENSMMUG00000005312 transcript:ENSMMUT00000007479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEFVNGKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
LQQLTGARTVPRVFIGKDCIGGCSDLVSMQQSGELLTRLKQIGALQ
Download sequence
Identical sequences A0A096N4P5 A0A2K5M5H4 A0A2K6AC69 A0A2K6EDD0 F7GJV9 Q25N99
ENSMMUP00000007028 ENSMMUP00000007028 9544.ENSMMUP00000007028 NP_001185651.1.72884 NP_001271943.1.63531 XP_005557467.1.63531 XP_005557468.1.63531 XP_005557469.1.63531 XP_011757126.1.29376 XP_011757127.1.29376 XP_011757128.1.29376 XP_011844819.1.47321 XP_011844820.1.47321 XP_011844821.1.47321 XP_011844822.1.47321 XP_011944356.1.92194 XP_011944357.1.92194 XP_011944358.1.92194 XP_011944359.1.92194 XP_014995928.1.72884 XP_014995929.1.72884 XP_014995930.1.72884 ENSPANP00000007370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]