SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007034 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007034
Domain Number 1 Region: 387-523
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.21e-38
Family Gelsolin-like 0.0000537
Further Details:      
 
Domain Number 2 Region: 243-435
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.66e-36
Family C-terminal, gelsolin-like domain of Sec23/24 0.011
Further Details:      
 
Domain Number 3 Region: 589-724
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 7.32e-34
Family Gelsolin-like 0.000037
Further Details:      
 
Domain Number 4 Region: 6-146
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.91e-30
Family Gelsolin-like 0.000018
Further Details:      
 
Domain Number 5 Region: 509-609
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 4.46e-24
Family Gelsolin-like 0.00045
Further Details:      
 
Domain Number 6 Region: 122-232
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.88e-23
Family C-terminal, gelsolin-like domain of Sec23/24 0.014
Further Details:      
 
Domain Number 7 Region: 756-821
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 1.44e-21
Family VHP, Villin headpiece domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007034   Gene: ENSMMUG00000005319   Transcript: ENSMMUT00000007486
Sequence length 821
Comment pep:known chromosome:MMUL_1:11:54885328:54904497:-1 gene:ENSMMUG00000005319 transcript:ENSMMUT00000007486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLTSAFRAVDNDPGIIVWRIEKMELALVPVRAHGNFYEGDCYVILSTRRVASLLSQDIH
FWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHRETVPTHYQKVTHPVYFKAASVYKKGG
VASGMKHVETNTYNVKRLLHVKGKRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPE
SNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPELMKVLQDTLGRRSIIKPAVP
DEIIDQQQKSNIMLYHVSDSPGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGK
GATKAEKQAAMSKALGFIKMKGYPSSTNVETVNDGAESAMFKQLFQKWSVKDQTMGLGKT
FSIGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGSGKVEVWRIENLELVPVEYQWYGFF
YGGDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRM
GTEPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLN
SNDVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLCDGSENTVAEGQESAEFWDLLGGK
TPYASDKRLQQEILDVQSRLFECSNKTGQFIVTEITDFTQDDLNPGDVMLLDTWDQVFLW
IGAEANATEKKSALATAQQYLLTHPSGRDPDTPILIIKQGFEPPIFTGWFLAWDPNIWSA
GKSYEQLKEELGDAAAIMQITADMKNATLSVNSIDSESKYYPIAVLLKNQNQELPEDVNP
AKKENYLSEQDFVSVFGITRGQFAALPGWKQLQMKKEKGLF
Download sequence
Identical sequences ENSMMUP00000007034 ENSMMUP00000007034 9544.ENSMMUP00000007034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]