SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007176 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007176
Domain Number 1 Region: 145-400
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 76-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.11e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007176   Gene: ENSMMUG00000005430   Transcript: ENSMMUT00000007640
Sequence length 414
Comment pep:known_by_projection chromosome:MMUL_1:7:76233545:76240427:1 gene:ENSMMUG00000005430 transcript:ENSMMUT00000007640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Download sequence
Identical sequences A0A1U7R1X2 A0A2I3HRX8 A0A2I3N666 A0A2K5LN11 A0A2K5Q4E7 A0A2K5UHX2 A0A2K6CL30 A0A2K6GAH6 A0A2K6RWV3 F1D8R0 F7ICX7 G3RXP9 H0XPC9 H2QA47 P24468 P43135 Q3UST6
HR6377 ENSPTRP00000012788 ENSOGAP00000017970 ENSMMUP00000007176 ENSNLEP00000015072 ENSP00000377721 ENSCJAP00000010966 ENSMUSP00000032768 ENSMUSP00000032768 ENSNLEP00000015072 ENSCJAP00000010946 ENSGGOP00000020586 ENSP00000377721 10090.ENSMUSP00000032768 9544.ENSMMUP00000007176 9598.ENSPTRP00000012788 9606.ENSP00000329908 ENSOGAP00000017970 ENSMMUP00000007176 ENSGGOP00000008460 gi|14149746|ref|NP_066285.1| ENSMUSP00000032768 NP_033827.2.92730 NP_066285.1.87134 NP_066285.1.92137 XP_001099957.1.72884 XP_001135545.1.37143 XP_002749136.1.60252 XP_003268580.1.23891 XP_003788693.1.62490 XP_005083998.1.91757 XP_005357821.1.66349 XP_005560624.1.63531 XP_006984478.1.50099 XP_010359627.1.97406 XP_011735621.1.29376 XP_011933092.1.92194 XP_012499220.1.63892 XP_012619955.1.48125 XP_017373821.1.71028 XP_018866529.1.27298 XP_021047685.1.100879 XP_021514772.1.76796 XP_021514774.1.76796 ENSP00000377721 ENSPTRP00000012788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]