SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007301 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007301
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.05e-26
Family Cadherin 0.00021
Further Details:      
 
Domain Number 2 Region: 262-376
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-24
Family Cadherin 0.00071
Further Details:      
 
Domain Number 3 Region: 378-481
Classification Level Classification E-value
Superfamily Cadherin-like 6.81e-23
Family Cadherin 0.0033
Further Details:      
 
Domain Number 4 Region: 67-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000209
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 482-593
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000257
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007301   Gene: ENSMMUG00000005520   Transcript: ENSMMUT00000007771
Sequence length 796
Comment pep:known chromosome:MMUL_1:20:63193953:63250488:-1 gene:ENSMMUG00000005520 transcript:ENSMMUT00000007771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENYCLQAALVCLGMLCHSQAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYSIVDGDGMELFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKIAVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRILD
VNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDDS
Download sequence
Identical sequences A0A096NJ47 A0A0D9QXB9 A0A2K5IM58 A0A2K5M9M6 A0A2K5YPU4 A0A2K6E2P6 A0A2K6MC99 A0A2K6PT09 F7GFF0 G7Q1A8
9544.ENSMMUP00000007301 ENSMMUP00000007301 ENSPANP00000012996 NP_001253542.1.72884 XP_005592191.1.63531 XP_005592192.1.63531 XP_007991744.1.81039 XP_007991746.1.81039 XP_007991747.1.81039 XP_007991748.1.81039 XP_010353494.1.97406 XP_011756270.1.29376 XP_011756271.1.29376 XP_011756272.1.29376 XP_011807608.1.43180 XP_011807609.1.43180 XP_011843292.1.47321 XP_011919375.1.92194 XP_011919379.1.92194 XP_014981800.1.72884 XP_014981801.1.72884 XP_014981802.1.72884 XP_015298482.1.63531 XP_015298483.1.63531 XP_017744538.1.44346 XP_017744539.1.44346 XP_017744540.1.44346 XP_017744541.1.44346 XP_017744542.1.44346 ENSMMUP00000007301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]