SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007422 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007422
Domain Number 1 Region: 317-568
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.99e-109
Family STAT DNA-binding domain 0.000000000266
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 9.22e-66
Family STAT 0.00000000861
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.57e-44
Family Transcription factor STAT-4 N-domain 0.0000181
Further Details:      
 
Domain Number 4 Region: 569-710
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-44
Family SH2 domain 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007422   Gene: ENSMMUG00000005613   Transcript: ENSMMUT00000007897
Sequence length 750
Comment pep:known chromosome:MMUL_1:12:54702288:54745613:-1 gene:ENSMMUG00000005613 transcript:ENSMMUT00000007897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNAV
Download sequence
Identical sequences A0A096MQY8 A0A0D9RIE1 A0A1D5R5F0 A0A2K5N4U8 A0A2K5W636 A0A2K5ZQ22 A0A2K6APP5 Q4R4G2
ENSMMUP00000007422 NP_001248543.1.72884 XP_005573832.1.63531 XP_007963860.1.81039 XP_007963861.1.81039 XP_011716558.1.29376 XP_011829613.1.47321 XP_011902705.1.92194 XP_014966058.1.72884 9544.ENSMMUP00000007422 ENSPANP00000002174 ENSMMUP00000007422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]