SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007424 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007424
Domain Number 1 Region: 316-564
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-99
Family STAT DNA-binding domain 0.0000000464
Further Details:      
 
Domain Number 2 Region: 136-316
Classification Level Classification E-value
Superfamily STAT 3.14e-58
Family STAT 0.0000103
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 9.15e-44
Family Transcription factor STAT-4 N-domain 0.000000386
Further Details:      
 
Domain Number 4 Region: 565-701
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-43
Family SH2 domain 0.00000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007424   Gene: ENSMMUG00000005617   Transcript: ENSMMUT00000007899
Sequence length 741
Comment pep:known chromosome:MMUL_1:12:54763282:54889282:-1 gene:ENSMMUG00000005617 transcript:ENSMMUT00000007899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMMNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNNMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPVQRIHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSVEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENVPENPLKY
LYPDIPKDKAFGRHYSSQPCEVSRPTERGGKGYVPSVFIPISTIRSDSMEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAV
Download sequence
Identical sequences 9544.ENSMMUP00000007424 ENSMMUP00000007424 ENSMMUP00000007424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]