SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007429 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007429
Domain Number 1 Region: 560-678
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-31
Family Cadherin 0.0019
Further Details:      
 
Domain Number 2 Region: 240-365
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.00079
Further Details:      
 
Domain Number 3 Region: 463-564
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 136-244
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 5 Region: 668-776
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-17
Family Cadherin 0.012
Further Details:      
 
Domain Number 6 Region: 352-461
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-16
Family Cadherin 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007429
Domain Number - Region: 29-122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000251
Family Cadherin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007429   Gene: ENSMMUG00000005620   Transcript: ENSMMUT00000007904
Sequence length 1203
Comment pep:known chromosome:MMUL_1:17:46409058:47358511:-1 gene:ENSMMUG00000005620 transcript:ENSMMUT00000007904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA
SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPN
DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYE
LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQV
TVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK
RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDL
RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPVFNQPVIELSVSE
NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIF
TVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
AGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG
NNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN
ASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI
NGTISLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKK
HHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPLHTRQSQRRVTFH
LPDGSQESCSDSGLGDHEPVGSGTLISHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSD
GPLGPRGLAEATEMCTQECLVLGHSDNCWMPPGLGPYQHPKSPLSTFVPQKEWVKKDKLV
NGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGAIESPKE
HQL
Download sequence
Identical sequences A0A2K5VCH6 F6WDU0
ENSMMUP00000007429 XP_005586034.1.63531 XP_014976649.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]