SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007443 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007443
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000424
Family Growth factor receptor domain 0.0052
Further Details:      
 
Domain Number 2 Region: 206-249
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000314
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 108-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family Fibronectin type I module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007443   Gene: ENSMMUG00000005631   Transcript: ENSMMUT00000007918
Sequence length 357
Comment pep:known chromosome:MMUL_1:8:121924177:121932115:1 gene:ENSMMUG00000005631 transcript:ENSMMUT00000007918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGQCPTTPPTCAPGVRAVLDG
CSCCPVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICMAVEGDNCVFDGVIYRSG
EKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDS
LGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQ
TRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRC
CTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Download sequence
Identical sequences A0A096MUT5 A0A2K5M816 F6WCM6 G8F5V5
ENSMMUP00000007443 ENSPANP00000003604 NP_001253825.1.72884 XP_011912811.1.92194 ENSMMUP00000007443 9544.ENSMMUP00000007443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]