SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007444 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007444
Domain Number 1 Region: 510-599
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-17
Family SPRY domain 0.0092
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.65e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000121
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 4 Region: 375-423,467-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000255
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007444
Domain Number - Region: 106-161
Classification Level Classification E-value
Superfamily RING/U-box 0.00175
Family ZZ domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007444   Gene: ENSMMUG00000005632   Transcript: ENSMMUT00000007919
Sequence length 603
Comment pep:known_by_projection chromosome:MMUL_1:X:106554598:106635143:1 gene:ENSMMUG00000005632 transcript:ENSMMUT00000007919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVSSCSSGESIEPITAFQCPTCR
YVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSESRRERTYRPSTAMSSERIACQ
FCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHRLVEPVPDTHLRGITCLDHEN
EKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLKQTLEMNLTNLVKRNSELENQ
MAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVA
NCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINFNDAFE
NFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTI
FTGQANFISKSWCSWGLWPEIRKCKEAVSCSRLAGAPRGKCLYNSVDSWMIVPNIKQNHY
TVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEK
DESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWI
GKN
Download sequence
Identical sequences ENSMMUP00000007444 9544.ENSMMUP00000007444 ENSMMUP00000007444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]