SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007482 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007482
Domain Number 1 Region: 391-550
Classification Level Classification E-value
Superfamily Lipocalins 5.41e-47
Family Rv2717c-like 0.0000685
Further Details:      
 
Domain Number 2 Region: 1-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000684
Family THAP domain 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007482
Domain Number - Region: 273-365
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0837
Family MED7 hinge region 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007482   Gene: ENSMMUG00000005662   Transcript: ENSMMUT00000007961
Sequence length 552
Comment pep:known chromosome:MMUL_1:12:105515947:105558542:-1 gene:ENSMMUG00000005662 transcript:ENSMMUT00000007961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFPLKDSKRLIQWLKAVQRDNWTPTKYSFLCSEHFTKDSFSKRLEDQHRLLKPTAVPSIF
HLTEKKRGAGGHGRTRRKDASKATGGVRGHSSAATGRGATGWSPSSSGNPMAKPESRRLK
RAALQGEAAPRAAQEAASQEQAQQALERTPGDGLATTVAGSQGKAEVSATDAGDESTTPS
IEGGVADKSGISMDDFTPPGSGACKFIGSLHSYSFSSKHTRERPSVPREPIDRKRPKKDV
EPSCSGSSLGPDKGLAQSPPGSSLTATPQKPSQSPSAPPADVTPKPATEAVQSQHSDASP
MSINEVILSASGACKLIDSLHSYCFSSRQNKSQVCCLREQVEKKNGELKSLRQRVSRSDS
QVRKLQEKLDELRRVSVPYPSGLLSPSREPPKMNPVVEPLSWMLGTWLSDPPGAGTYPTL
QPFQYLEEVHISHVGQPMLNFSFNSFHPDTRKPMHRECGFIRLKPDTNKVAFVSAQNTGV
VEVEEGEVNGQELCIASHSIARISFAKEPHVEQITRKFRLNSEGKLEQTVSMATTTQPMT
QHLHVTYKKVTP
Download sequence
Identical sequences ENSMMUP00000007482 ENSMMUP00000037273 9544.ENSMMUP00000007482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]