SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007515 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007515
Domain Number 1 Region: 6-172
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.99e-56
Family G proteins 0.0000000413
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007515   Gene: ENSMMUG00000005692   Transcript: ENSMMUT00000007995
Sequence length 194
Comment pep:known chromosome:MMUL_1:18:4592012:4740071:-1 gene:ENSMMUG00000005692 transcript:ENSMMUT00000007995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGI
KLVKPTSQASRRCC
Download sequence
Identical sequences A0A096MS58 A0A0D9RY92 A0A2K5WP53 A0A2K6BTN2 F6U587
ENSPANP00000002619 ENSMMUP00000007515 9544.ENSMMUP00000007515 ENSMMUP00000007515 XP_005587243.1.63531 XP_007972855.1.81039 XP_011734916.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]