SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007541 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007541
Domain Number 1 Region: 47-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.21e-121
Family Bee venom hyaluronidase 0.0000162
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007541
Domain Number - Region: 429-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0128
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007541   Gene: ENSMMUG00000005718   Transcript: ENSMMUT00000008022
Sequence length 481
Comment pep:known_by_projection chromosome:MMUL_1:3:161390335:161404255:1 gene:ENSMMUG00000005718 transcript:ENSMMUT00000008022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPEGQLRLCFVQPVHLTLWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPDEDFSGLAVIDWEYWRPQWARNWNAKDVYRKKSRKLITDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYTGSCPEE
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSQFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTSSKANCTKVKQFVSS
DLGSYLANVTRAAEVCSFHLCRNNGRCIRKMWNSPTYLHLNPASYHIEASEDGEFTVKGR
ASDTDLAVMADTFSCHCYQGYEGADCREVKTADGCSGVSPFPGSLITLCLLLLASYRSIH
L
Download sequence
Identical sequences F6TY89 G7P0K1
XP_014990302.1.72884 9544.ENSMMUP00000007541 ENSMMUP00000007541 ENSMMUP00000007541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]