SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007545 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007545
Domain Number 1 Region: 106-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 2 Region: 196-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000763
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 152-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000016
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 4 Region: 57-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000878
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007545
Domain Number - Region: 549-778
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00504
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007545   Gene: ENSMMUG00000005722   Transcript: ENSMMUT00000008027
Sequence length 786
Comment pep:known chromosome:MMUL_1:19:14087638:14107606:1 gene:ENSMMUG00000005722 transcript:ENSMMUT00000008027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFCVWLTLLGAETQDSRDCARWCPENSSCVNATACRCNPGFSSSSEIFTSPTEICDDINE
CVPPSKVSCGKSSDCRNTEGSYDCVCNPGYELVSGAKTFKNESENTCQDVDECQQNPRLC
KSYGTCVNTLGSFTCQCLPGFKFKPEDPKLCTDVNECTSGQNPCHSSTHCLNNVGSYQCR
CRPGWQPIPGSPNGPNNTICEDVDECSSGLHQCDNSTVCFNIVGSYTCRCRPGWEPKHGI
PNNQKDTVCKEMNFPTWTLPPGVHSQTLSQFFNKVQDLDRDFKTSSANVTIQNLIKLVDE
LMEAPGDIEALAPSVRHLIATQLLSNLEDILRILAKTLPEGPFTYLSPSNTELTLMIQKQ
GDKNVTMGQSNARMKLNWAVAAGAKDPGPAVAGILSIQNMTTLLANASLNLHSKKQAELE
EIYESNIRGVRLRRLSAVNSVFLSHNNTKELNFPILFAFSHLESSGGKEGRDPPAKDVMP
GPRQELICAFWKSDSNRGGHWATEGCRVLGSKNGSTTCQCSHLSSFAILMAHYDLEDWKL
SLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICLFVGSTIFLAGIENEGGQ
VGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGLSTRWLCLIGYGVPLLIV
GVSAAVYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVIFVTTVWKLTQKFSEINP
DMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYVFTILNCLQGAFLYLLHC
LLNKKV
Download sequence
Identical sequences 9544.ENSMMUP00000007545 ENSMMUP00000007545 ENSMMUP00000007545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]