SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007612 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007612
Domain Number 1 Region: 602-720
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.0017
Further Details:      
 
Domain Number 2 Region: 504-605
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-28
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 178-287
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 287-390
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 5 Region: 709-819
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-17
Family Cadherin 0.0066
Further Details:      
 
Domain Number 6 Region: 421-509
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000157
Family Cadherin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007612   Gene: ENSMMUG00000005766   Transcript: ENSMMUT00000008095
Sequence length 925
Comment pep:known_by_projection chromosome:MMUL_1:17:40556026:40561492:-1 gene:ENSMMUG00000005766 transcript:ENSMMUT00000008095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLHRPRSSTSHRILPHLFLFFLFVEPFSCLASHSRATELLYSLNEGLPAGVLIGSLAE
DLRLLPRSAGRLDPHSQLPERTGAEWNPPLSFSLASRGLSGQYVTLDNRSGELHTSAQEI
DREALCLEGGGGTAWGGSVSISSSPSSDSCLLLLDVLVLPQEYFRFVKVKIAIRDINDNA
PQFPVSQISVWVPENAPVNTRLAIEHPAVDPDVGINGVQTYRLLDYHGMFTLDVEENENG
ERTPYLIVMGALDRETQDQYVSIIIAEDGGSPPLLGSATLTIGISDINDNCPLFTDSQIN
VTVYGNATVGTPIAAVQAVDKDLGTNAQITYSYSQKVPQASKDLFHLDENTGVIKLFNKI
GGSVLQSHKLTILANGPGCIPAVITALVSVIKVIFRPPEIVPRYIANEIDGVVYLKELEP
VNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPYKPYNNEYLLETTKPMDYELQQFYEVA
VVAWNSEGFHVKRVIKVQLLDDNDNAPIFLQPLIELTIEENNSPNAFLTKLYATDADSGE
RGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDREEKERYRYTVRAVDGGKPPRESVATVA
LTVLDKNDNSPRFINKDFSFFVPENFPGYGEIGVISVTDADAGRNGWVALSVVNQSDIFV
IDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGEPALSSTAKITILLLDINDNPPLVLFPQ
SNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAVIAYSIIGRRGPRPESFRIDPKTGNITL
EEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVNLFVNDTVSNESYIESLLRKEPEINIE
EKEPQISIEPTHRKVESVSCMPTLVALSVISLGSITLVTGMGIYICLRKGKKHPREDENL
EVQIPLKGKIDLHMRERKPMDISNI
Download sequence
Identical sequences ENSMMUP00000007612 9544.ENSMMUP00000007612 ENSMMUP00000007612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]