SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007678 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007678
Domain Number 1 Region: 84-215
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.11e-46
Family Glutathione S-transferase (GST), C-terminal domain 0.00000022
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.73e-24
Family Glutathione S-transferase (GST), N-terminal domain 0.00000819
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007678   Gene: ENSMMUG00000019630   Transcript: ENSMMUT00000008164
Sequence length 216
Comment pep:known chromosome:MMUL_1:1:112718005:112736004:1 gene:ENSMMUG00000019630 transcript:ENSMMUT00000008164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPY
LIDGTHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEK
LKPEYLEGLPTMMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPKCLDAFPNLK
DFISHFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
Download sequence
Identical sequences ENSMMUP00000007678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]