SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007726 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007726
Domain Number 1 Region: 306-382
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 3.14e-27
Family VHP, Villin headpiece domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007726   Gene: ENSMMUG00000005870   Transcript: ENSMMUT00000008219
Sequence length 382
Comment pep:known_by_projection chromosome:MMUL_1:8:21990519:22005638:1 gene:ENSMMUG00000005870 transcript:ENSMMUT00000008219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLQKQPLTSPGSVSPSRDSSVPGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPD
LMIYEPHFTYSLLEHVELPRSRERSLSPKSTSPPPSPEVMPESAAPWLSLASSVSIILIE
RVVLPHFHHPETSRPDSNIYKKPPIYKQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDP
NQPAKIETDYWPCPPSLAVVETEWRKRKASRRRAEEEEEEEDDDSGEEMKALRERQREEL
SKVTSNLGKMILKEEMEKSLPIRRKTRSLPDRTPFHTSLHQGTSKSSSLPAYGRTTLSRL
QSTEFSPSGSETGSPGLQIYPYEMLVVTNKGRTKLPPGVDRMRLERHLSAEDFSRVFAMS
PEEFGKLALWKRNELKKKASLF
Download sequence
Identical sequences ENSMMUP00000007726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]