SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007737 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007737
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 3.21e-234
Family Phosphoglucose isomerase, PGI 8.56e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007737   Gene: ENSMMUG00000005880   Transcript: ENSMMUT00000008231
Sequence length 558
Comment pep:known chromosome:MMUL_1:19:40926355:40964914:1 gene:ENSMMUG00000005880 transcript:ENSMMUT00000008231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRDPQFQKLQQWYREHGSELNLRRLFDADKDRFNHFSLTLNTNHGHILLDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSEGPR
VWYVSNIDGTHIAKTLTQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
Download sequence
Identical sequences I0FQZ3 Q4R591
ENSMMUP00000007737 9544.ENSMMUP00000007737 XP_014979008.1.72884 ENSMMUP00000007737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]