SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007745 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000007745
Domain Number 1	Region: 98-169
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000119
Family	LIM domain	0.013
Further Details:

Domain Number 2	Region: 36-103
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000000191
Family	LIM domain	0.011
Further Details:

Domain Number 3	Region: 8-34
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000452
Family	LIM domain	0.041
Further Details:

Weak hits

Sequence:	ENSMMUP00000007745
Domain Number -	Region: 166-200
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0939
Family	LIM domain	0.021
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000007745 Gene: ENSMMUG00000005887 Transcript: ENSMMUT00000008239
Sequence length	213
Comment	pep:novel chromosome:MMUL_1:19:41058468:41069224:1 gene:ENSMMUG00000005887 transcript:ENSMMUT00000008239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	ASPLLGICIKCGLGIYGAQQACQAMGSLYHTDCFTCDSCGRRLRGKAFYNVGEKVYCQED FLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPGCFRCSVCNECLDGVPFTVDVENNIY CVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVACYHCEDCGLQLSGEEGRR CYPLAGHLLCRRCHLRRLQPGPVPSPTVHVTEL
Download sequence
Identical sequences	G7NM31 G7PX72 9544.ENSMMUP00000007745 ENSMMUP00000007745 ENSMMUP00000007745

SEARCH