SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007764 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007764
Domain Number 1 Region: 103-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 766-834
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000381
Family Homeodomain 0.00047
Further Details:      
 
Domain Number 3 Region: 498-553
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000513
Family Homeodomain 0.0069
Further Details:      
 
Domain Number 4 Region: 613-673
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000077
Family Homeodomain 0.0008
Further Details:      
 
Domain Number 5 Region: 315-370
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000642
Family Homeodomain 0.01
Further Details:      
 
Domain Number 6 Region: 846-887
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000372
Family Homeodomain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007764
Domain Number - Region: 77-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00417
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007764   Gene: ENSMMUG00000005904   Transcript: ENSMMUT00000008260
Sequence length 969
Comment pep:known chromosome:MMUL_1:10:23159105:23272943:1 gene:ENSMMUG00000005904 transcript:ENSMMUT00000008260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMIPVKTVVVQDASMEAQPTETLPEGPQQDLPPEAPVASSEAAQNPSSTD
GSTLANGHRSTLDGYLYSCKYCDFRSHDMTQFVGHMNSEHTDFNKDPTFVCSGCSFLAKS
PEGLSLHNATCHSGEASFVWNVAKPDNHVVVEQSVPESTSTPDLAGEPSAEGADGQAEII
ITKTPIMKIMKGKAEAKKIHTLKENVPSQPVGEALPKLSTGEMEVREGDHSFINGAVPVS
QASASSAKNPHAANGPLIGTVPVLPAGIAQFLSLQQQPPVHTQHHAHQPLPTAKALPKVM
IPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQRLKQG
ISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQHLIQAALPGHVVGQPEG
TGGGLLVTQPLMANGLQATSSSLPLTVTSVPKQPGVAPINTVCSNTTSAVKVVNAAQSLL
TACPSITSQAFLDASIYKNKKSHEQLSALKGSFCRNQFPGQSEVEHLTKVTGLSTREVRK
WFSDRRYHCRNLKGSRVTMPGDHSSMIIDSVPEVSFSPSSKVPEVTCVPTTATLATHPSA
KRQSWHQTPDFTPTKYKERAPEQLRALESSFAQNPLPLDEELDRLRSETKMTRREIDSWF
SERRKKVNAEETKKAEENASQEEEEAVEDEGGEEDLASELRVSGENGSLEMPSSHILAER
KVSPIKINLKNLRVTEANGRNEIPGLGACDPEDDGSNKLAEQLPGKVSCKKTAQQRHLLR
QLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRYALKNGQLKWYEDYKRGNFPPGLL
VIAPGNRELLQDYYITHKMMYEEDLQNLCDKTQMSSQQVKQWFAEKMGEETRAVADTGSE
DQGPGTGELTAVHKGMGDTYSEVSENSESWEPSVPEASSEPFDTSSPQAGRQLGSWSLSS
QPLPSLLTL
Download sequence
Identical sequences ENSMMUP00000007764 ENSMMUP00000037938 XP_015004457.1.72884 XP_015004459.1.72884 XP_015004460.1.72884 XP_015004461.1.72884 XP_015004462.1.72884 XP_015004463.1.72884 XP_015004464.1.72884 XP_015004465.1.72884 XP_015004466.1.72884 XP_015004467.1.72884 XP_015004468.1.72884 XP_015004469.1.72884 XP_015004470.1.72884 XP_015004471.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]