SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007892 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007892
Domain Number 1 Region: 57-261
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.33e-71
Family Proteasome subunits 0.00000000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007892   Gene: ENSMMUG00000006007   Transcript: ENSMMUT00000008401
Sequence length 266
Comment pep:known chromosome:MMUL_1:7:85854956:85864267:-1 gene:ENSMMUG00000006007 transcript:ENSMMUT00000008401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLDMALASVLERPLPVNQRGFFGLGGRADLLDIGPGSPSDGLSLAAPGWGVPEEPGIEML
HGTTTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERL
LARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEG
NRISGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYH
VREDGWIRVSSDNVADLHEKYSGSTP
Download sequence
Identical sequences ENSMMUP00000007892 9544.ENSMMUP00000007892 ENSMMUP00000007892 ENSPANP00000015594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]