SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007895 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007895
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.33e-29
Family Proteasome subunits 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007895   Gene: ENSMMUG00000006008   Transcript: ENSMMUT00000008404
Sequence length 102
Comment pep:known_by_projection chromosome:MMUL_1:7:85871752:85872914:1 gene:ENSMMUG00000006008 transcript:ENSMMUT00000008404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYRGLDLCVATALCGWDRSGPMLFYVYSDGTRLQGNIFSVGSGSPYAYGVLDRGYRYD
MSTQEAYALARCAVAHATHRDAYSGGSVDLFHVRESGWEHVS
Download sequence
Identical sequences 9544.ENSMMUP00000007895 ENSMMUP00000007895 ENSMMUP00000007895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]