SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007896 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007896
Domain Number 1 Region: 143-251
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.00024
Further Details:      
 
Domain Number 2 Region: 252-367
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 371-457
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 64-150
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000014
Family Cadherin 0.0016
Further Details:      
 
Domain Number 5 Region: 511-615
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000271
Family Cadherin 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007896   Gene: ENSMMUG00000006009   Transcript: ENSMMUT00000008405
Sequence length 819
Comment pep:known chromosome:MMUL_1:7:85876687:85885624:-1 gene:ENSMMUG00000006009 transcript:ENSMMUT00000008405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLVRLLLAWLGGWGCMGRLAAPARAWAGSRGHPGPALLRTRRSWVWNQFFVIEEYAGP
EPVLIGKLHSDVDRGEGRTKYLLTGEGAGTVFVIDEATGNIHVTKSLDREEKAQYVLLAQ
AVDRASNRPLEPPSEFIIKVQDINDNPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDP
SYGNSAKLVYTVLDGLPFFSVDPQTGVVRTAIPNMDRETQEEFLVVIQAKDMGGHMGGLS
GSTTVTVTLSDVNDNPPKFPQSLYQFSVVETAGPGTLVGRLRAQDPDLGDNALMAYSILD
GEGSEAFSISTDSQGRDGLLTVRKPLDFESRRSYAFRVEATNTLIDPAYLRRGPFKDVAS
VRVVVQDAPEPPAFTQAAYHLTVPENKAPGTLVGQISAADLDSPASPIRYSILPHSDPER
CFSIQPEEGTIHTAAPLDREARVWHNLTVLATELGWSWGPERGWVPPLVAKWSTPTAPPQ
ISPVGSPVGIPQDSSAQASRVQVTIQTLDENDNAPQLAEPYDTFVCDSAAPGQLIQVIQA
LDRDEVGNSSHVSFQGPLGPDANFTVRDNRDGSASLLLPSRPAPPRQAPYLVPIELWDWG
QPALSSTATVTVSVCRCQPDGSVASCWPEAHLSAAGLSTGALLAIITCVGALLALVVLFV
ALRRQKQEALMVLEEEDVRENIITYDDEGGGEEDTEAFDITALQNPDGAAPQAPGPPARR
DVLPRARVSRQPRPPGPADVAQLLVLRLREADEDPSVPPYDSVQVYGYEGRGSSCGSLSS
LGSGSEAGGVPGPAEPLDDWGPLFRTLAELYGAKEPPAP
Download sequence
Identical sequences A0A2K5TYS0 F6UDC8
XP_001105292.1.72884 XP_015309061.1.63531 ENSMMUP00000007896 ENSMMUP00000007896 9544.ENSMMUP00000007896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]