SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007897 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007897
Domain Number 1 Region: 83-187
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000828
Family Cadherin 0.005
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007897
Domain Number - Region: 59-89
Classification Level Classification E-value
Superfamily Cadherin-like 0.0879
Family Cadherin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007897   Gene: ENSMMUG00000006009   Transcript: ENSMMUT00000008406
Sequence length 391
Comment pep:known chromosome:MMUL_1:7:85876692:85879642:-1 gene:ENSMMUG00000006009 transcript:ENSMMUT00000008406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIVCTWYCSIHSTTLLSTCTLHAYFMCFLCMLYAACGIHAHAPHMLCVNCVMCVWVCFG
VLASDSSAQASRVQVTIQTLDENDNAPQLAEPYDTFVCDSAAPGQLIQVIQALDRDEVGN
SSHVSFQGPLGPDANFTVRDNRDGSASLLLPSRPAPPRQAPYLVPIELWDWGQPALSSTA
TVTVSVCRCQPDGSVASCWPEAHLSAAGLSTGALLAIITCVGALLALVVLFVALRRQKQE
ALMVLEEEDVRENIITYDDEGGGEEDTEAFDITALQNPDGAAPQAPGPPARRDVLPRARV
SRQPRPPGPADVAQLLVLRLREADEDPSVPPYDSVQVYGYEGRGSSCGSLSSLGSGSEAG
GVPGPAEPLDDWGPLFRTLAELYGAKEPPAP
Download sequence
Identical sequences ENSMMUP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]