SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007987 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007987
Domain Number 1 Region: 406-593
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-17
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 2 Region: 595-690
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-16
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 3 Region: 327-405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000395
Family I set domains 0.042
Further Details:      
 
Domain Number 4 Region: 776-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000742
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007987
Domain Number - Region: 132-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0105
Family I set domains 0.072
Further Details:      
 
Domain Number - Region: 220-256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007987   Gene: ENSMMUG00000006080   Transcript: ENSMMUT00000008499
Sequence length 824
Comment pep:known chromosome:MMUL_1:15:49882682:49985413:-1 gene:ENSMMUG00000006080 transcript:ENSMMUT00000008499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLASLVLCGVSLLLSGTVEGAMDLILINSLPLVSDAETSLTCIASGWHPHEPITIGRD
FEALMNQHQDPLEVTQDVTREWAKKVVWKREKASKINGAYFCEGRVRGEAIRIRTMKMRQ
QASFLPATLTMTVDKGDNVNISFKKVLIKEEDAVIYKNGSFIHSVPRHEVPDILEVHLPH
AQPQDAGVYSARYIGGNLFTSAFTRLIVRRCEAQKWGPECNRLCTVCVNNGVCHEDTGEC
ICPPGFMGRTCEKACERHTFGRTCKERCSGQDGCKSYVFCLPDPYGCSCATGWKGLQCNE
GIPRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLHPKDFNHTDH
FSVAIFTIHRILPPDSGVWVCSANTVAGMVEKPFNISVKVLPKPLNAPNVIDTGHNFAVI
NISSEPYFGDGPIKSKKLLYKPVNHYEAWRHIQVTNEIVTLNHLEPRTEYELCVQLVRRG
EGGEGHPGPVRRFTTASIGLPPPRGLNLLPKSQTTLNLTWQPIFPSSEDDFYVEVERRSV
QKSDQQNIKVPGNLTSVLLNNLHPREQYVVRARVNTKAQGEWSEDLTAWTLSDILPPQPE
NIKISNITHSSAVISWTILDGYSISSITIRYKVQGKNEDQHIDVKIKNATITQYQLKGLE
PETAYQVDIFAENNIGSSNPAFSHELVTLPESEAPADLGGGKMLLIAILGSAGMTCLTVL
LAFLIILQLKRANVQRRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWND
IKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHR
Download sequence
Identical sequences ENSMMUP00000007987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]