SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000007989 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000007989
Domain Number 1 Region: 485-593
Classification Level Classification E-value
Superfamily SEA domain 0.000000000144
Family SEA domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000007989
Domain Number - Region: 437-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 408-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00219
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000007989   Gene: ENSMMUG00000006081   Transcript: ENSMMUT00000008501
Sequence length 777
Comment pep:novel chromosome:MMUL_1:3:48242421:48251414:1 gene:ENSMMUG00000006081 transcript:ENSMMUT00000008501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVRTTLRSTENTPITSFSTSIVVTPETPTQTAPVLTSATGTQTFPVPTTVTVGSIDSS
TSTLHTLTPSTALSTIMSTSQVPIPSTRSSTLQTSASTPSLQTSLTSTSEFTTESFTRGS
TSTNAILTSFSTIIWSSTPTIIMSSSLSSTSITPLFYTTTHSVPSSAYTFSTENMGSSSI
TAFPTLSSSATTSTSPTSSSLTTALTEITPFSYISLPSTTPCPETITITIVPASPTDPCV
EMDSSTEATSPPPTPLTVLPFTTEMVTCPSSISMQTTLATYMDTSSMTPESESSITTNAS
SSTGTGTVPTNTVFTSTEMPTSETWLSTSFVTPPHLPGVSTIPLTTKPSSSLPTILRTSS
KSAHSSPSTTRTSETPVATTQTPTTLTSRRTTPTTSQTTTQSTLTTTAGTCDNGGTWEQG
QCACRPGFSGDRCQFQTSCLNGGQWDNIKCQCPSTFYGSRCEFAVEQVDLDVVETEVGME
VSVDQEFSPDLNDNTSQAYRDFNKTFWNQMQKIFSGMRGFTFKGVEILSLRNGSIVVDYL
VLLELPFSSQLGSQYEQAKTTLKEALQNASQDADSCQDSQTLCFKPDSIKVNNNSRTELT
SEAICRRAAPAGYEKFYFPLEEATRLRCVTNCTSGVDNAINCHQGQCVLERSGPTCRCYS
TDTHWFSGPRCEVAIHWRALVGGLTAGVALLLLLLLALGFWAVRSGWWGGQRLDRSWDQD
RKWFESWDEEVVGTFSNWGFQDDENPDKDKNFHVALEKVDTTMKVHIKRPEMTSSSV
Download sequence
Identical sequences 9544.ENSMMUP00000007989 ENSMMUP00000007989 ENSMMUP00000007989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]