SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008183 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008183
Domain Number 1 Region: 334-551
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.38e-25
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 
Domain Number 2 Region: 142-248
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0043
Further Details:      
 
Domain Number 3 Region: 33-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000243
Family Cadherin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008183   Gene: ENSMMUG00000006225   Transcript: ENSMMUT00000008708
Sequence length 971
Comment pep:known chromosome:MMUL_1:1:12784789:12893203:-1 gene:ENSMMUG00000006225 transcript:ENSMMUT00000008708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNAVLLDPPLI
ALDKDAPLRFAGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCELQKDYSFTIQA
YDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVVEGKQYDSILRVEAMDA
DCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAYDCGKKRATED
VLVKISVKPTCAPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQATVELETSHI
GKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTVGLPTDNGHDSDQVFEFNGTQA
VRIPDGIVSVNPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSLYVHGCRLIFL
LRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHEPFSVTEDYPL
HPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQYFRGNLAGLTLRSGKLA
DKKVIDCLYTCKEGLDLQVPEDSGRGVQIQAHPSQLVLTLEGEDIGELDKAMQHISYLNS
RQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGVHHFARAASEF
ESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTCEVTVEGEELN
HEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNWHARSLLDRKF
KLICSELNGRYISNEFKVEVNVIHTANPVEHANHMAAQPQFVHPEHRSFVDLSGHNLANP
HPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQDTGKENEMDWDDSALTI
TVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQGDPQNATRQQ
QLEWDDSTLSY
Download sequence
Identical sequences F7HLC4
ENSMMUP00000008183 XP_015298418.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]