SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008185 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008185
Domain Number 1 Region: 344-561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.47e-25
Family Clostridium neurotoxins, the second last domain 0.056
Further Details:      
 
Domain Number 2 Region: 152-258
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000171
Family Cadherin 0.0043
Further Details:      
 
Domain Number 3 Region: 40-164
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000999
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008185   Gene: ENSMMUG00000006225   Transcript: ENSMMUT00000008710
Sequence length 981
Comment pep:known chromosome:MMUL_1:1:12784789:12893333:-1 gene:ENSMMUG00000006225 transcript:ENSMMUT00000008710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRPAPALAPAARLLLAGLLCGGGVWAARVNKHKPWLEPTYHGIVTENDNAVLLDPPLI
ALDKDAPLRFAESFEVTVTKEGEICGFKIHGQNVPFDAVVVDKSTGEGVIRSKEKLDCEL
QKDYSFTIQAYDCGKGPDGTNVKKSHKATVHIQVNDVNEYAPVFKEKSYKATVVEGKQYD
SILRVEAMDADCSPQFSQICSYEIITPDVPFTVDKDGYIKNTEKLNYGKEHQYKLTVTAY
DCGKKRATEDVLVKISVKPTCAPGWQGWNNRIEYEPGTGALAVFPNIHLETCDEPVASVQ
ATVELETSHIGKGCDRDTYSEKSLHRLCGAAAGTAELLPSPSGSLNWTVGLPTDNGHDSD
QVFEFNGTQAVRIPDGIVSVNPKEPFTISVWMRHGPFGRKKETILCSSDKTDMNRHHYSL
YVHGCRLIFLLRQDPSEEKKYRPAEFHWKLNQVCDEEWHHYVLNVEFPSVTLYVDGTSHE
PFSVTEDYPLHPSKIETQLVVGACWQEFSGVENDNETEPVTVASAGGDLHMTQYFRGNLA
GLTLRSGKLADKKVIDCLYTCKEGLDLQVPEDSGRGVQIQAHPSQLVLTLEGEDIGELDK
AMQHISYLNSRQFPTPGIRRLKITSTIKCFNEATCISVPPVDGYVMVLQPEEPKISLSGV
HHFARAASEFESSEGVFLFPELRIISTITREVEPEGDGAEDPTVQESLVSEEIVHDLDTC
EVTVEGEELNHEQESLEVDMARLQQKGIEVSSSELGMTFTGVDTMASYEEVLHLLRYRNW
HARSLLDRKFKLICSELNGRYISNEFKVEVNVIHTANPVEHANHMAAQPQFVHPEHRSFV
DLSGHNLANPHPFAVVPSTATVVIVVCVSFLVFMIILGVFRIRAAHQRTMRDQDTGKENE
MDWDDSALTITVNPMETYEDQHSSEEEEEEEEEEESEDGEEEDDITSAESESSEEEEGEQ
GDPQNATRQQQLEWDDSTLSY
Download sequence
Identical sequences F7HLB8
9544.ENSMMUP00000008185 XP_015298412.1.63531 ENSMMUP00000008183 ENSMMUP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]