SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008231 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008231
Domain Number 1 Region: 210-469
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.71e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000634
Further Details:      
 
Domain Number 2 Region: 471-577
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.07e-25
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 3 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000523
Family TGS domain 0.0049
Further Details:      
 
Domain Number 4 Region: 122-172
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000000222
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008231   Gene: ENSMMUG00000006256   Transcript: ENSMMUT00000008758
Sequence length 588
Comment pep:known_by_projection chromosome:MMUL_1:1:128866770:128886973:1 gene:ENSMMUG00000006256 transcript:ENSMMUT00000008758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRWRRLRLQGLQACRLHTAVVSTPPRWLAERLGLFEELWSAQVKRLASIAQKEPRT
IKISLPGGQKIDAVAWNTTPYQLARQISSTLADTAVAAQVNGEPYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTEYGFYHDFFLGNGRTVRGSELPH
GLRAQEDHTADTLPGFLPVTLTFHFCTHLQAEYARRGFSEVKTPTLFSTKLWEQSGHWEH
YQEDMFAVQPSGSDRPASSQSDDSTRHTTDILALKPMNCPAHCLMFAHRPRSWRELPLRL
ADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSF
RLALSTRPSGFLGDPCLWDQAEQVLQRALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGR
PHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLW
LSPFQVVVIPVGTEQEEYAREAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFV
VGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNMRVPNAEEIF
Download sequence
Identical sequences ENSMMUP00000008231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]