SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008280 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008280
Domain Number 1 Region: 232-356
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 2 Region: 448-569
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 129-236
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.0066
Further Details:      
 
Domain Number 4 Region: 345-452
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-18
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 615-694
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000186
Family Cadherin 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008280
Domain Number - Region: 30-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.00957
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008280   Gene: ENSMMUG00000006291   Transcript: ENSMMUT00000008809
Sequence length 1184
Comment pep:known_by_projection chromosome:MMUL_1:6:138354972:138369393:-1 gene:ENSMMUG00000006291 transcript:ENSMMUT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQLLQLLLGLLGPGGYFFLLGDGQEVTTLTVKYQVSEEVPSGTVIGKLSQELGREERQR
QAGAAFQVLQLPQALPIHVDSEEGLLSTGRRLDREQLCRQWDPCLVSFDVLATGDLALIH
VEIQVLDINDHQPRFPKGEQELEISESASLRTRIPLDRALDPDTGPNTLHTYTLSPSEHF
ALDVIVGPDETKHAELVVVKELDREIHSFFDLVLTAYDNGNPPKSGTSLVKVNVLDSNDN
SPVFAESSLALEIQEDAAPGTLLIKLTATDPDQGPNGEVEFFLSKHMPPEVLDTFSIDAK
TGQVILRRPLDYEKNPAYEVDVQARDLGPNPIPAHCKVLIKVLDVNDNIPSIHVTWASQP
SLVSEALPKDSFIALVMADDLDSGNNGLVHCWLSQELGHFRLKRTNGNTYMLLTNATLDR
EQWPKYTLTLLAQDQGLQPLSAKKQLSIHISDINDNAPVFEKSRYEVSTRENNVPSLHLI
TIKAQDADLGINGKVSYRIHDSPVAHLVAIDSNTGEVTAQRSLNYEEMAGFEFQVIAEDS
GQPMLASSVSVRVSLLDANDNAPEVVQPVLSDGKASLSVLVNASTGHLLVPIETPNGLGP
AGTDTPPLATHSSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILSPHAGQLFVNV
TNASSLIGSEWELEIVVEDQGSPPLQTRALLRIMFVTSADHLRDSARKPGALSMSMLTVI
CLTVLLGIFGLILALFMSICRTEKKDNRAYNCREAESTYRQQPKRPQKHIQKADIHLVPM
LRGQAGEPCEVGQSHKDMDKEAMMEAGWDPCLQAPFHLTPTLYRTLRNQGNQGAPAESRE
VLQDTVNLLFNHPRQRNASRENLNLPEPQPATGQPRSRPLKVAGSPTGRLAGDQGSEEAP
QSPPASSATLRRQRHLNGKVSPEKELGPRQILRSLVRLSVAAFAERNPVEELTVDSPPVQ
QISQLLSLLHQGQFQPKPNHRGNKYLAKPGGSRSAITDTDGPSARAGGQTDPEQEEGPLD
PEEDLSVKQLLEEELSSLLDPCTGLALDRLSAPDPAWMARLSLPLTTNYRDNVISPDAAA
TEEPRTFQTFGKAEAPELSPTGTRLASTFVSEMSSLLEMLLEQRSGMPVEAASEALRRLS
VCGRTLSLDLATSAASGMKVQGDPGGKTGTEGRSRGSSSSGSCL
Download sequence
Identical sequences ENSMMUP00000008280 ENSMMUP00000008280 9544.ENSMMUP00000008280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]