SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008295 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000008295
Domain Number - Region: 2-36
Classification Level Classification E-value
Superfamily FnI-like domain 0.00324
Family VWC domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008295   Gene: ENSMMUG00000006303   Transcript: ENSMMUT00000008825
Sequence length 286
Comment pep:novel chromosome:MMUL_1:3:166204052:166210683:-1 gene:ENSMMUG00000006303 transcript:ENSMMUT00000008825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTVRCQSRRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQ
GSCSYVLAKDCHSGDFSVHVTNDDRGRSGVAWTQEVAVLLGDVAVRLLQGGAVTVDGRPV
ALPFLQEPLLYVELRGHTVILHTQPGLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFA
QDDLQGPEGLLLPTEAAFGNSWQVQKGCGCPPGLELPLVLLQMERSRRAQEQLLWDLELL
TGVELGLFWPPQAQFFSPRGQAQHAWSQHCQPGGSTGGDPEQLVSG
Download sequence
Identical sequences G8F5A6
ENSMMUP00000008295 ENSMMUP00000008295 9544.ENSMMUP00000008295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]