SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008335 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008335
Domain Number 1 Region: 89-161
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.38e-19
Family L-aminoacid/polyamine oxidase 0.0022
Further Details:      
 
Domain Number 2 Region: 13-104
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.42e-16
Family FAD-linked reductases, N-terminal domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008335
Domain Number - Region: 189-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000216
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008335   Gene: ENSMMUG00000006326   Transcript: ENSMMUT00000008865
Sequence length 233
Comment pep:known_by_projection chromosome:MMUL_1:9:133015231:133027672:1 gene:ENSMMUG00000006326 transcript:ENSMMUT00000008865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATGSVGKAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERSF
GGVVEVGAHWIHGPSRGNPDAWFRKLIGFVVLPAFASVHVLCGFIAGLESEFMETLSDEE
VLLCLTQVLQKMTGNPQLPAPKSVLRSRWHSAPYTRGSYSYVAVGSTGGDLDLLAQPLPA
DGAGAQLQILFAGEATHRTFYSTTHGALLSGWREADRLLSLWAPQVQQPRPRL
Download sequence
Identical sequences ENSMMUP00000008335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]