SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008370 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008370
Domain Number 1 Region: 417-601
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-17
Family Laminin G-like module 0.031
Further Details:      
 
Domain Number 2 Region: 624-819
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-16
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 3 Region: 833-1032
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.55e-16
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 4 Region: 149-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000152
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 111-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000153
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 323-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000116
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 361-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000675
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 227-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000139
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 9 Region: 187-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000541
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 10 Region: 1062-1102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000774
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 11 Region: 77-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000649
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1178-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.013
Further Details:      
 
Domain Number 13 Region: 1097-1135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000059
Family EGF-type module 0.02
Further Details:      
 
Domain Number 14 Region: 265-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000163
Family EGF-type module 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000008370
Domain Number - Region: 1140-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0155
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008370   Gene: ENSMMUG00000006345   Transcript: ENSMMUT00000008901
Sequence length 1288
Comment pep:known_by_projection chromosome:MMUL_1:15:12356763:12379339:-1 gene:ENSMMUG00000006345 transcript:ENSMMUT00000008901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARPGTRDTQPLAYVLLLLLLLLWAPALSLLAGTVPSEPPSACASDPCAPGTECQATK
SGGYTCGPTEPRGCATQPCHHGALCVPQGLDPDGFRCYCVPGFQGPRCELDIDECASRPC
HHGATCRNLADRYECHCPLGYAGVTCETEVDECASAPCVHGGSCLDGVGSFRCVCAPGYG
GTRCQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTRCEQEVLECASAPCAHNAS
CLEGLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDPALYGGVQATLRGTFS
FRHAAGFVCHCPPGFEGADCGVEVDECASRPCLNGGRCQDLPNGFQCHCPDGYAGPTCEE
DVDECLSDPCLHGGNCSDTVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCIPIFES
GVHSYVCHCPPGTHGPFCGQNTTFSVMAGRPIQASVPAGGPLGLALRFRTTLPAGTLATR
NDTRESLELALVAATLQATLWSHGTTVLVLRLPDLGLNDGHWHQVEVVLHLATLELRLWH
EGCPARLCVASGPVALAPTASATPLPAGISSAQLGDATFAGCLQDVRVDGHLLLPEDLGE
NVLLGCERREQCQPLPCVHGGSCVDLWTHFRCNCPRPHRGPTCADEIPAATFGLGGAPSS
VSFLLQELPGPNLTLSFLLRTRESAGLLLQFANDSAAGLTVFLSEGRIRAEAPGGPAVVL
PGRWDDGLRHLVTLSFGPEQLQDLGQHMHVGGRLLAADSQPWGGPFRGCLQDLRLDGRHL
PFFPLPLDNSSQPSELGGRQSWNLTAGCVSEDMCSPDPCFNGGTCLVTWNDFHCTCPANF
TGPTCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFHEGPPVAFSGHNASSGRSLGSLS
LAFRTRDSEAWLLRATAGALAGVWLAVRNGSLAGGVRGGHGLSGALLPIPGPRVADGAWH
RVRLAMERPAAAPSRWLLWLDGAATPVALRGLAGDLGFLQGPGAAHILLAENFTGCLGRV
ALGGLPLPLARPRPGVAPGAQEHFAAWPGTPAPILGCRGAPVCAPSPCLHGGDCRDLFDA
FACACGPGWEGPRCEAHVNPCDSAPCARGRCHTHPDGRFECHCPPGFGGPRCRLPVPSKE
CILNVTCLDGSPCEGGSPAVNCSCLEGLAGQRCQVPALPCETNPCLNGGTCRAAGGVSEC
ICNARFSGQFCEVVKGVPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGT
YSPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences ENSMMUP00000008370 ENSMMUP00000008371 9544.ENSMMUP00000008370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]