SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008371 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008371
Domain Number 1 Region: 624-819
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-16
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 2 Region: 833-1032
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-16
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 3 Region: 421-609
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.22e-16
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 4 Region: 149-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000986
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000268
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 323-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 7 Region: 361-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000625
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 8 Region: 227-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 9 Region: 187-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000485
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 10 Region: 1062-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000157
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 11 Region: 77-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000578
Family EGF-type module 0.013
Further Details:      
 
Domain Number 12 Region: 265-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000827
Family EGF-type module 0.009
Further Details:      
 
Domain Number 13 Region: 1097-1135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000129
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008371   Gene: ENSMMUG00000006345   Transcript: ENSMMUT00000008902
Sequence length 1185
Comment pep:known_by_projection chromosome:MMUL_1:15:12361408:12379339:-1 gene:ENSMMUG00000006345 transcript:ENSMMUT00000008902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALARPGTRDTQPLAYVLLLLLLLLWAPALSLLAGTVPSEPPSACASDPCAPGTECQATK
SGGYTCGPTEPRGCATQPCHHGALCVPQGLDPDGFRCYCVPGFQGPRCELDIDECASRPC
HHGATCRNLADRYECHCPLGYAGVTCETEVDECASAPCVHGGSCLDGVGSFRCVCAPGYG
GTRCQLDLDECQSQPCAHGGTCHDLVNGFRCDCAGTGYEGTRCEQEVLECASAPCAHNAS
CLEGLGSFRCLCWPGYSGELCEVDEDECASSPCQHGGRCLQRSDPALYGGVQATLRGTFS
FRHAAGFVCHCPPGFEGADCGVEVDECASRPCLNGGRCQDLPNGFQCHCPDGYAGPTCEE
DVDECLSDPCLHGGNCSDTVAGYICRCPETWGGRDCSVQLTGCQGHTCPLAATCIPIFES
GVHSYVCHCPPGTHGPFCGQNTTFSVMAGRPIQASVPAGGPLGLALRFRTTLPAGTLATR
NDTRESLELALVAATLQATLWSHGTTVLVLRLPDLGLNDGHWHQVEVVLHLATLELRLWH
EGCPARLCVASGPVALAPTASATPLPAGISSAQLGDATFAGCLQDVRVDGHLLLPEDLGE
NVLLGCERREQCQPLPCVHGGSCVDLWTHFRCNCPRPHRGPTCADEIPAATFGLGGAPSS
VSFLLQELPGPNLTLSFLLRTRESAGLLLQFANDSAAGLTVFLSEGRIRAEAPGGPAVVL
PGRWDDGLRHLVTLSFGPEQLQDLGQHMHVGGRLLAADSQPWGGPFRGCLQDLRLDGRHL
PFFPLPLDNSSQPSELGGRQSWNLTAGCVSEDMCSPDPCFNGGTCLVTWNDFHCTCPANF
TGPTCAQQLWCPGQPCLPPATCEEVPDGFVCVAEATFHEGPPVAFSGHNASSGRSLGSLS
LAFRTRDSEAWLLRATAGALAGVWLAVRNGSLAGGVRGGHGLSGALLPIPGPRVADGAWH
RVRLAMERPAAAPSRWLLWLDGAATPVALRGLAGDLGFLQGPGAAHILLAENFTGCLGRV
ALGGLPLPLARPRPGVAPGAQEHFAAWPGTPAPILGCRGAPVCAPSPCLHGGDCRDLFDA
FACACGPGWEGPRCEAHVNPCDSAPCARGRCHTHPDGRFECHCPPGFGGPRCRWDGWAGA
RARKGGWAANAPWDCGGAEKSARSVDELLPFPDPRVLICDMSRTV
Download sequence
Identical sequences ENSMMUP00000008371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]