SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008433 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008433
Domain Number 1 Region: 14-318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.02e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008433   Gene: ENSMMUG00000006392   Transcript: ENSMMUT00000008969
Sequence length 373
Comment pep:known chromosome:MMUL_1:9:66881291:66899969:1 gene:ENSMMUG00000006392 transcript:ENSMMUT00000008969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNIPFMLVDMKDSFHHNVAALRASVETG
FAKKTFISYSVTFKDNFRQGLVVGIDLKNQTVLLQGGEALPFSHLILATGSTGPFPGKFN
EVSSQQATIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALA
DKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVI
LCTGIKINNSAYRNAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGL
HANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLF
VSTSWKTMKQSPP
Download sequence
Identical sequences ENSMMUP00000008433 9544.ENSMMUP00000008433 ENSMMUP00000008433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]