SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000008439 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000008439
Domain Number 1 Region: 4-285
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-108
Family Inorganic pyrophosphatase 0.0000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000008439   Gene: ENSMMUG00000006397   Transcript: ENSMMUT00000008975
Sequence length 289
Comment pep:known chromosome:MMUL_1:9:66778913:66808479:1 gene:ENSMMUG00000006397 transcript:ENSMMUT00000008975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGI
SCMNTTVSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Download sequence
Identical sequences A0A096P4X1 A0A158SIP7 A0A2K5L3N8 A0A2K6AAV8 A0A2K6D605 H9EP38 Q4R543
ENSPANP00000020396 9544.ENSMMUP00000008439 ENSMMUP00000008439 NP_001270700.1.63531 XP_011713275.1.29376 XP_011846443.1.47321 XP_011940703.1.92194 XP_015002942.1.72884 ENSMMUP00000008439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]